PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10025822
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB_related
Protein Properties Length: 388aa    MW: 41979.7 Da    PI: 7.2099
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10025822genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.37.3e-13126170347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+g+W+ Iar     Rt+ q+ s+ qky
      Lus10025822 126 PWTEEEHRLFLIGLQKFGKGDWRGIARNYVVSRTPTQVASHAQKY 170
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.392119175IPR017930Myb domain
SuperFamilySSF466891.05E-16121176IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-18122174IPR006447Myb domain, plants
SMARTSM007173.2E-10123173IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-11123169IPR009057Homeodomain-like
PfamPF002491.4E-10126170IPR001005SANT/Myb domain
CDDcd001672.28E-9126171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MMTRRCSHCS NNGHNSRTWP KRSAALSGAA ALSGGASSSS LSSSAGVKLF GVRLTDGSFI  60
KKSASMGNLS ASHYHSSSSA AASPNHDSPV SDHVHDSGRP ADGYLSDDPA HGSSSSRRRD  120
RKKGVPWTEE EHRLFLIGLQ KFGKGDWRGI ARNYVVSRTP TQVASHAQKY FIRQSNATRR  180
KRRSSLFDMV PDVASDPQPV PEDKDEELPS LQQTRENDDS EDTLPSLNLS LKPEYEPMET  240
MSEEPAMKEE EEPNETTMES IESKPSKLFT STAPGSIKFT PYVHGFFPVH VPVPYTYWPV  300
DTAPIEEKLM VAETSKVLRP VAVVPKEPVN VEELVGISQL SLGDSAGLKL TVEASRQSAF  360
HAKAQGSGSD IVVGKGKKGS SNSIEAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572848.11e-147PREDICTED: uncharacterized protein LOC8273781 isoform X1
RefseqXP_002515966.11e-147PREDICTED: uncharacterized protein LOC8273781 isoform X2
TrEMBLB1Q4U51e-154B1Q4U5_BRUGY; Myb transcription factor
STRINGGLYMA13G43120.11e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-71MYB_related family protein